Anti TNS3 pAb (ATL-HPA055338 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA055338-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: tensin 3
Gene Name: TNS3
Alternative Gene Name: FLJ13732, H_NH0549I23.2, TEM6, TENS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020422: 75%, ENSRNOG00000025695: 75%
Entrez Gene ID: 64759
Uniprot ID: Q68CZ2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HLGPFTCHKSSQNSLLSDGFGSNVGEDPQGTLVPDLGLGMDGPYERERTFGSREPKQPQPLLRKPSVSAQMQAYGQSSYSTQTWVRQQQMVVAHQYSFAPDGEAR
Gene Sequence HLGPFTCHKSSQNSLLSDGFGSNVGEDPQGTLVPDLGLGMDGPYERERTFGSREPKQPQPLLRKPSVSAQMQAYGQSSYSTQTWVRQQQMVVAHQYSFAPDGEAR
Gene ID - Mouse ENSMUSG00000020422
Gene ID - Rat ENSRNOG00000025695
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TNS3 pAb (ATL-HPA055338 w/enhanced validation)
Datasheet Anti TNS3 pAb (ATL-HPA055338 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TNS3 pAb (ATL-HPA055338 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti TNS3 pAb (ATL-HPA055338 w/enhanced validation)
Datasheet Anti TNS3 pAb (ATL-HPA055338 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TNS3 pAb (ATL-HPA055338 w/enhanced validation)
Citations for Anti TNS3 pAb (ATL-HPA055338 w/enhanced validation) – 2 Found
Nizioł, Marcin; Zińczuk, Justyna; Zaręba, Konrad; Guzińska-Ustymowicz, Katarzyna; Pryczynicz, Anna. Immunohistochemical Analysis of the Expression of Adhesion Proteins: TNS1, TNS2 and TNS3 in Correlation with Clinicopathological Parameters in Gastric Cancer. Biomolecules. 2021;11(5)  PubMed
Shi, Yang; Xiang, Zheng; Yang, Huiyu; Khan, Suliman; Li, Ruizhe; Zhou, Siran; Ullah, Saif; Zhang, Jiyu; Liu, Bingrong. Pharmacological targeting of TNS3 with histone deacetylase inhibitor as a therapeutic strategy in esophageal squamous cell carcinoma. Aging. 2021;13(11):15336-15352.  PubMed