Anti TNS3 pAb (ATL-HPA055338 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA055338-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: TNS3
Alternative Gene Name: FLJ13732, H_NH0549I23.2, TEM6, TENS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020422: 75%, ENSRNOG00000025695: 75%
Entrez Gene ID: 64759
Uniprot ID: Q68CZ2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | HLGPFTCHKSSQNSLLSDGFGSNVGEDPQGTLVPDLGLGMDGPYERERTFGSREPKQPQPLLRKPSVSAQMQAYGQSSYSTQTWVRQQQMVVAHQYSFAPDGEAR |
| Gene Sequence | HLGPFTCHKSSQNSLLSDGFGSNVGEDPQGTLVPDLGLGMDGPYERERTFGSREPKQPQPLLRKPSVSAQMQAYGQSSYSTQTWVRQQQMVVAHQYSFAPDGEAR |
| Gene ID - Mouse | ENSMUSG00000020422 |
| Gene ID - Rat | ENSRNOG00000025695 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TNS3 pAb (ATL-HPA055338 w/enhanced validation) | |
| Datasheet | Anti TNS3 pAb (ATL-HPA055338 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti TNS3 pAb (ATL-HPA055338 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti TNS3 pAb (ATL-HPA055338 w/enhanced validation) | |
| Datasheet | Anti TNS3 pAb (ATL-HPA055338 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti TNS3 pAb (ATL-HPA055338 w/enhanced validation) |
| Citations for Anti TNS3 pAb (ATL-HPA055338 w/enhanced validation) – 2 Found |
| Nizioł, Marcin; Zińczuk, Justyna; Zaręba, Konrad; Guzińska-Ustymowicz, Katarzyna; Pryczynicz, Anna. Immunohistochemical Analysis of the Expression of Adhesion Proteins: TNS1, TNS2 and TNS3 in Correlation with Clinicopathological Parameters in Gastric Cancer. Biomolecules. 2021;11(5) PubMed |
| Shi, Yang; Xiang, Zheng; Yang, Huiyu; Khan, Suliman; Li, Ruizhe; Zhou, Siran; Ullah, Saif; Zhang, Jiyu; Liu, Bingrong. Pharmacological targeting of TNS3 with histone deacetylase inhibitor as a therapeutic strategy in esophageal squamous cell carcinoma. Aging. 2021;13(11):15336-15352. PubMed |