Anti TNNI2 pAb (ATL-HPA055938 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA055938-25

• 
• 
• 

Protein Description: troponin I type 2 (skeletal, fast)
Gene Name: TNNI2
Alternative Gene Name: AMCD2B, DA2B, FSSV
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031097: 90%, ENSRNOG00000020276: 94%
Entrez Gene ID: 7136
Uniprot ID: P48788
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ELEKEESRREAEKQNYLAEHCPPLHIPGSMSEVQELCKQLHAKIDAAEEEKYDMEVRVQKTSK
• Gene Sequence: ELEKEESRREAEKQNYLAEHCPPLHIPGSMSEVQELCKQLHAKIDAAEEEKYDMEVRVQKTSK
• Gene ID - Mouse: ENSMUSG00000031097
• Gene ID - Rat: ENSRNOG00000020276
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.