Anti TNNC2 pAb (ATL-HPA058481 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA058481-25
  • Immunohistochemistry analysis in human skeletal muscle and heart muscle tissues using Anti-TNNC2 antibody. Corresponding TNNC2 RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & vesicles.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: troponin C type 2 (fast)
Gene Name: TNNC2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017300: 100%, ENSRNOG00000015155: 100%
Entrez Gene ID: 7125
Uniprot ID: P02585
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ARSYLSEEMIAEFKAAFDMFDADGGGDISVKE
Gene Sequence ARSYLSEEMIAEFKAAFDMFDADGGGDISVKE
Gene ID - Mouse ENSMUSG00000017300
Gene ID - Rat ENSRNOG00000015155
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti TNNC2 pAb (ATL-HPA058481 w/enhanced validation)
Datasheet Anti TNNC2 pAb (ATL-HPA058481 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TNNC2 pAb (ATL-HPA058481 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti TNNC2 pAb (ATL-HPA058481 w/enhanced validation)
Datasheet Anti TNNC2 pAb (ATL-HPA058481 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TNNC2 pAb (ATL-HPA058481 w/enhanced validation)