Anti TNKS2 pAb (ATL-HPA036606)

Atlas Antibodies

Catalog No.: ATL-HPA036606-25

Protein Description: tankyrase, TRF1-interacting ankyrin-related ADP-ribose polymerase 2
Gene Name: TNKS2
Alternative Gene Name: PARP-5b, PARP-5c, PARP5B, PARP5C, pART6, TANK2, TNKL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024811: 78%, ENSRNOG00000059776: 80%
Entrez Gene ID: 80351
Uniprot ID: Q9H2K2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SLDNLSGSFSELSSVVSSSGTEGASSLEKKEVPGVDFSITQFVRNLGLEH
• Gene Sequence: SLDNLSGSFSELSSVVSSSGTEGASSLEKKEVPGVDFSITQFVRNLGLEH
• Gene ID - Mouse: ENSMUSG00000024811
• Gene ID - Rat: ENSRNOG00000059776
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.