Anti TNIP2 pAb (ATL-HPA063197)

Atlas Antibodies

Catalog No.:
ATL-HPA063197-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: TNFAIP3 interacting protein 2
Gene Name: TNIP2
Alternative Gene Name: ABIN-2, FLIP1, KLIP, MGC4289
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059866: 79%, ENSRNOG00000013805: 82%
Entrez Gene ID: 79155
Uniprot ID: Q8NFZ5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EDLNAKWQRYNASRDEYVRGLHAQLRGLQIPHEPELMRKEISRLNRQLEEKINDCAEVKQELAASRTARDAALERVQM
Gene Sequence EDLNAKWQRYNASRDEYVRGLHAQLRGLQIPHEPELMRKEISRLNRQLEEKINDCAEVKQELAASRTARDAALERVQM
Gene ID - Mouse ENSMUSG00000059866
Gene ID - Rat ENSRNOG00000013805
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TNIP2 pAb (ATL-HPA063197)
Datasheet Anti TNIP2 pAb (ATL-HPA063197) Datasheet (External Link)
Vendor Page Anti TNIP2 pAb (ATL-HPA063197) at Atlas Antibodies

Documents & Links for Anti TNIP2 pAb (ATL-HPA063197)
Datasheet Anti TNIP2 pAb (ATL-HPA063197) Datasheet (External Link)
Vendor Page Anti TNIP2 pAb (ATL-HPA063197)