Anti TNFSF9 pAb (ATL-HPA059857)

Atlas Antibodies

Catalog No.:
ATL-HPA059857-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: tumor necrosis factor (ligand) superfamily, member 9
Gene Name: TNFSF9
Alternative Gene Name: 4-1BB-L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000008855: 26%, ENSRNOG00000045595: 39%
Entrez Gene ID: 8744
Uniprot ID: P41273
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGL
Gene Sequence SGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGL
Gene ID - Mouse ENSMUSG00000008855
Gene ID - Rat ENSRNOG00000045595
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TNFSF9 pAb (ATL-HPA059857)
Datasheet Anti TNFSF9 pAb (ATL-HPA059857) Datasheet (External Link)
Vendor Page Anti TNFSF9 pAb (ATL-HPA059857) at Atlas Antibodies

Documents & Links for Anti TNFSF9 pAb (ATL-HPA059857)
Datasheet Anti TNFSF9 pAb (ATL-HPA059857) Datasheet (External Link)
Vendor Page Anti TNFSF9 pAb (ATL-HPA059857)