Anti TNFSF9 pAb (ATL-HPA059857)
Atlas Antibodies
- Catalog No.:
- ATL-HPA059857-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: TNFSF9
Alternative Gene Name: 4-1BB-L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000008855: 26%, ENSRNOG00000045595: 39%
Entrez Gene ID: 8744
Uniprot ID: P41273
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGL |
| Gene Sequence | SGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGL |
| Gene ID - Mouse | ENSMUSG00000008855 |
| Gene ID - Rat | ENSRNOG00000045595 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TNFSF9 pAb (ATL-HPA059857) | |
| Datasheet | Anti TNFSF9 pAb (ATL-HPA059857) Datasheet (External Link) |
| Vendor Page | Anti TNFSF9 pAb (ATL-HPA059857) at Atlas Antibodies |
| Documents & Links for Anti TNFSF9 pAb (ATL-HPA059857) | |
| Datasheet | Anti TNFSF9 pAb (ATL-HPA059857) Datasheet (External Link) |
| Vendor Page | Anti TNFSF9 pAb (ATL-HPA059857) |