Anti TNFSF12 pAb (ATL-HPA052967)

Atlas Antibodies

Catalog No.:
ATL-HPA052967-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: tumor necrosis factor (ligand) superfamily, member 12
Gene Name: TNFSF12
Alternative Gene Name: APO3L, DR3LG, TWEAK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018752: 84%, ENSRNOG00000045670: 81%
Entrez Gene ID: 8742
Uniprot ID: O43508
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QEPAQEELVAEEDQDPSELNPQTEESQDPAPFLNRLVRPRRSAPKGRKTRARRAIAAHYEVHPRPGQDGAQAGVDGTVSGWEEARINSSSPLRYNRQIGEFIVTRAGLYYLYC
Gene Sequence QEPAQEELVAEEDQDPSELNPQTEESQDPAPFLNRLVRPRRSAPKGRKTRARRAIAAHYEVHPRPGQDGAQAGVDGTVSGWEEARINSSSPLRYNRQIGEFIVTRAGLYYLYC
Gene ID - Mouse ENSMUSG00000018752
Gene ID - Rat ENSRNOG00000045670
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TNFSF12 pAb (ATL-HPA052967)
Datasheet Anti TNFSF12 pAb (ATL-HPA052967) Datasheet (External Link)
Vendor Page Anti TNFSF12 pAb (ATL-HPA052967) at Atlas Antibodies

Documents & Links for Anti TNFSF12 pAb (ATL-HPA052967)
Datasheet Anti TNFSF12 pAb (ATL-HPA052967) Datasheet (External Link)
Vendor Page Anti TNFSF12 pAb (ATL-HPA052967)