Anti TNFRSF9 pAb (ATL-HPA071425)

Atlas Antibodies

Catalog No.:
ATL-HPA071425-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: tumor necrosis factor receptor superfamily, member 9
Gene Name: TNFRSF9
Alternative Gene Name: 4-1BB, CD137, ILA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028965: 58%, ENSRNOG00000036942: 59%
Entrez Gene ID: 3604
Uniprot ID: Q07011
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQII
Gene Sequence KGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQII
Gene ID - Mouse ENSMUSG00000028965
Gene ID - Rat ENSRNOG00000036942
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TNFRSF9 pAb (ATL-HPA071425)
Datasheet Anti TNFRSF9 pAb (ATL-HPA071425) Datasheet (External Link)
Vendor Page Anti TNFRSF9 pAb (ATL-HPA071425) at Atlas Antibodies

Documents & Links for Anti TNFRSF9 pAb (ATL-HPA071425)
Datasheet Anti TNFRSF9 pAb (ATL-HPA071425) Datasheet (External Link)
Vendor Page Anti TNFRSF9 pAb (ATL-HPA071425)