Anti TNFRSF8 pAb (ATL-HPA032081)

Atlas Antibodies

Catalog No.: ATL-HPA032081-25

Protein Description: tumor necrosis factor receptor superfamily, member 8
Gene Name: TNFRSF8
Alternative Gene Name: CD30, D1S166E, KI-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028602: 60%, ENSRNOG00000016782: 53%
Entrez Gene ID: 943
Uniprot ID: P28908
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTS
• Gene Sequence: DTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTS
• Gene ID - Mouse: ENSMUSG00000028602
• Gene ID - Rat: ENSRNOG00000016782
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.