Anti TNFRSF14 pAb (ATL-HPA006404)

Atlas Antibodies

Catalog No.:
ATL-HPA006404-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: tumor necrosis factor receptor superfamily, member 14
Gene Name: TNFRSF14
Alternative Gene Name: ATAR, CD270, HVEA, HVEM, LIGHTR, TR2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042333: 54%, ENSRNOG00000013820: 52%
Entrez Gene ID: 8764
Uniprot ID: Q92956
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PPGDWGPPPWRSTPKTDVLRLVLYLTFLGAPCYAPALPSCKEDEYPVGSECCPKCSPGYRVKEACGELTGTVCEPCPPGTYIAHLNGLSKCLQCQMCD
Gene Sequence PPGDWGPPPWRSTPKTDVLRLVLYLTFLGAPCYAPALPSCKEDEYPVGSECCPKCSPGYRVKEACGELTGTVCEPCPPGTYIAHLNGLSKCLQCQMCD
Gene ID - Mouse ENSMUSG00000042333
Gene ID - Rat ENSRNOG00000013820
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TNFRSF14 pAb (ATL-HPA006404)
Datasheet Anti TNFRSF14 pAb (ATL-HPA006404) Datasheet (External Link)
Vendor Page Anti TNFRSF14 pAb (ATL-HPA006404) at Atlas Antibodies

Documents & Links for Anti TNFRSF14 pAb (ATL-HPA006404)
Datasheet Anti TNFRSF14 pAb (ATL-HPA006404) Datasheet (External Link)
Vendor Page Anti TNFRSF14 pAb (ATL-HPA006404)