Anti TNFRSF10A pAb (ATL-HPA050958)
Atlas Antibodies
- Catalog No.:
- ATL-HPA050958-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: TNFRSF10A
Alternative Gene Name: Apo2, CD261, DR4, TRAILR-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034164: 37%, ENSRNOG00000009863: 44%
Entrez Gene ID: 8797
Uniprot ID: O00220
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ATPSKVWGSSAGRIEPRGGGRGALPTSMGQHGPSA |
Gene Sequence | ATPSKVWGSSAGRIEPRGGGRGALPTSMGQHGPSA |
Gene ID - Mouse | ENSMUSG00000034164 |
Gene ID - Rat | ENSRNOG00000009863 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti TNFRSF10A pAb (ATL-HPA050958) | |
Datasheet | Anti TNFRSF10A pAb (ATL-HPA050958) Datasheet (External Link) |
Vendor Page | Anti TNFRSF10A pAb (ATL-HPA050958) at Atlas Antibodies |
Documents & Links for Anti TNFRSF10A pAb (ATL-HPA050958) | |
Datasheet | Anti TNFRSF10A pAb (ATL-HPA050958) Datasheet (External Link) |
Vendor Page | Anti TNFRSF10A pAb (ATL-HPA050958) |