Anti TNFRSF10A pAb (ATL-HPA050958)

Atlas Antibodies

Catalog No.:
ATL-HPA050958-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: tumor necrosis factor receptor superfamily, member 10a
Gene Name: TNFRSF10A
Alternative Gene Name: Apo2, CD261, DR4, TRAILR-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034164: 37%, ENSRNOG00000009863: 44%
Entrez Gene ID: 8797
Uniprot ID: O00220
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ATPSKVWGSSAGRIEPRGGGRGALPTSMGQHGPSA
Gene Sequence ATPSKVWGSSAGRIEPRGGGRGALPTSMGQHGPSA
Gene ID - Mouse ENSMUSG00000034164
Gene ID - Rat ENSRNOG00000009863
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TNFRSF10A pAb (ATL-HPA050958)
Datasheet Anti TNFRSF10A pAb (ATL-HPA050958) Datasheet (External Link)
Vendor Page Anti TNFRSF10A pAb (ATL-HPA050958) at Atlas Antibodies

Documents & Links for Anti TNFRSF10A pAb (ATL-HPA050958)
Datasheet Anti TNFRSF10A pAb (ATL-HPA050958) Datasheet (External Link)
Vendor Page Anti TNFRSF10A pAb (ATL-HPA050958)