Anti TNFRSF10A pAb (ATL-HPA050958)

Atlas Antibodies

SKU: ATL-HPA050958-25

• 

Protein Description: tumor necrosis factor receptor superfamily, member 10a
Gene Name: TNFRSF10A
Alternative Gene Name: Apo2, CD261, DR4, TRAILR-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034164: 37%, ENSRNOG00000009863: 44%
Entrez Gene ID: 8797
Uniprot ID: O00220
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ATPSKVWGSSAGRIEPRGGGRGALPTSMGQHGPSA
• Gene Sequence: ATPSKVWGSSAGRIEPRGGGRGALPTSMGQHGPSA
• Gene ID - Mouse: ENSMUSG00000034164
• Gene ID - Rat: ENSRNOG00000009863
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.