Anti TNFAIP3 pAb (ATL-HPA067479)
Atlas Antibodies
- Catalog No.:
- ATL-HPA067479-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: TNFAIP3
Alternative Gene Name: A20, OTUD7C
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019850: 94%, ENSRNOG00000049517: 94%
Entrez Gene ID: 7128
Uniprot ID: P21580
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | AEQVLPQALYLSNMRKAVKIRERTPEDIFKPTNGIIHHFKTMHRYTLEMFRTCQFCPQFREIIHKALIDRNIQATLESQKKLNWCREV |
| Gene Sequence | AEQVLPQALYLSNMRKAVKIRERTPEDIFKPTNGIIHHFKTMHRYTLEMFRTCQFCPQFREIIHKALIDRNIQATLESQKKLNWCREV |
| Gene ID - Mouse | ENSMUSG00000019850 |
| Gene ID - Rat | ENSRNOG00000049517 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TNFAIP3 pAb (ATL-HPA067479) | |
| Datasheet | Anti TNFAIP3 pAb (ATL-HPA067479) Datasheet (External Link) |
| Vendor Page | Anti TNFAIP3 pAb (ATL-HPA067479) at Atlas Antibodies |
| Documents & Links for Anti TNFAIP3 pAb (ATL-HPA067479) | |
| Datasheet | Anti TNFAIP3 pAb (ATL-HPA067479) Datasheet (External Link) |
| Vendor Page | Anti TNFAIP3 pAb (ATL-HPA067479) |