Anti TNC pAb (ATL-HPA004823)

Atlas Antibodies

Catalog No.: ATL-HPA004823-25

Protein Description: tenascin C
Gene Name: TNC
Alternative Gene Name: DFNA56, HXB, MGC167029, TN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028364: 84%, ENSRNOG00000058645: 86%
Entrez Gene ID: 3371
Uniprot ID: P24821
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RLVKLIPGVEYLVSIIAMKGFEESEPVSGSFTTALDGPSGLVTANITDSEALARWQPAIATVDSYVISYTGEKVPEITRTVSGNTVEYALTDLEPATEYTLRIFAEKGPQKSSTITAKFTTDLDSPRDLTATEV
• Gene Sequence: RLVKLIPGVEYLVSIIAMKGFEESEPVSGSFTTALDGPSGLVTANITDSEALARWQPAIATVDSYVISYTGEKVPEITRTVSGNTVEYALTDLEPATEYTLRIFAEKGPQKSSTITAKFTTDLDSPRDLTATEV
• Gene ID - Mouse: ENSMUSG00000028364
• Gene ID - Rat: ENSRNOG00000058645
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TNC pAb (ATL-HPA004823) – 8 Found

Ghosh, Zhumur; Huang, Mei; Hu, Shijun; Wilson, Kitchener D; Dey, Devaveena; Wu, Joseph C. Dissecting the oncogenic and tumorigenic potential of differentiated human induced pluripotent stem cells and human embryonic stem cells. Cancer Research. 2011;71(14):5030-9. 

Qi, J; Esfahani, D R; Huang, T; Ozark, P; Bartom, E; Hashizume, R; Bonner, E R; An, S; Horbinski, C M; James, C D; Saratsis, A M. Tenascin-C expression contributes to pediatric brainstem glioma tumor phenotype and represents a novel biomarker of disease. Acta Neuropathologica Communications. 2019;7(1):75. 

Schenke-Layland, Katja; Stock, Ulrich A; Nsair, Ali; Xie, Jiansong; Angelis, Ekaterini; Fonseca, Carissa G; Larbig, Robert; Mahajan, Aman; Shivkumar, Kalyanam; Fishbein, Michael C; MacLellan, William R. Cardiomyopathy is associated with structural remodelling of heart valve extracellular matrix. European Heart Journal. 2009;30(18):2254-65. 

Edlund, Karolina; Lindskog, Cecilia; Saito, Akira; Berglund, Anders; Pontén, Fredrik; Göransson-Kultima, Hanna; Isaksson, Anders; Jirström, Karin; Planck, Maria; Johansson, Leif; Lambe, Mats; Holmberg, Lars; Nyberg, Fredrik; Ekman, Simon; Bergqvist, Michael; Landelius, Per; Lamberg, Kristina; Botling, Johan; Ostman, Arne; Micke, Patrick. CD99 is a novel prognostic stromal marker in non-small cell lung cancer. International Journal Of Cancer. 2012;131(10):2264-73. 

Bohonowych, J E; Hance, M W; Nolan, K D; Defee, M; Parsons, C H; Isaacs, J S. Extracellular Hsp90 mediates an NF-κB dependent inflammatory stromal program: implications for the prostate tumor microenvironment. The Prostate. 2014;74(4):395-407. 

Xu, Yingqiang; Li, Zhonghu; Jiang, Peng; Wu, Guo; Chen, Kai; Zhang, Xi; Li, Xiaowu. The co-expression of MMP-9 and Tenascin-C is significantly associated with the progression and prognosis of pancreatic cancer. Diagnostic Pathology. 2015;10( 26652622):211. 

Wijetunga, Imeshi; McVeigh, Laura E; Charalambous, Antonia; Antanaviciute, Agne; Carr, Ian M; Nair, Amit; Prasad, K Raj; Ingram, Nicola; Coletta, P Louise. Translating Biomarkers of Cholangiocarcinoma for Theranosis: A Systematic Review. Cancers. 2020;12(10) 

Xie, Qionghong; Zhang, Min; Mao, Xiaoyi; Xu, Mingyue; Liu, Shaojun; Shang, Da; Xu, Yunyu; Chen, Ruiying; Guan, Yi; Huang, Xinzhong; Zent, Roy; Pozzi, Ambra; Hao, Chuan-Ming. Matrix protein Tenascin-C promotes kidney fibrosis via STAT3 activation in response to tubular injury. Cell Death & Disease. 2022;13(12):1044.