Anti TMX2 pAb (ATL-HPA063763)

Atlas Antibodies

Catalog No.:
ATL-HPA063763-100
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: thioredoxin-related transmembrane protein 2
Gene Name: TMX2
Alternative Gene Name: PDIA12, TXNDC14
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050043: 79%, ENSRNOG00000005308: 79%
Entrez Gene ID: 51075
Uniprot ID: Q9Y320
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ENVIREFNLNELYQRAKKLSKAGDNIPEEQPVASTPTTVSDGENKKDK
Gene Sequence ENVIREFNLNELYQRAKKLSKAGDNIPEEQPVASTPTTVSDGENKKDK
Gene ID - Mouse ENSMUSG00000050043
Gene ID - Rat ENSRNOG00000005308
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TMX2 pAb (ATL-HPA063763)
Datasheet Anti TMX2 pAb (ATL-HPA063763) Datasheet (External Link)
Vendor Page Anti TMX2 pAb (ATL-HPA063763) at Atlas Antibodies

Documents & Links for Anti TMX2 pAb (ATL-HPA063763)
Datasheet Anti TMX2 pAb (ATL-HPA063763) Datasheet (External Link)
Vendor Page Anti TMX2 pAb (ATL-HPA063763)