Anti TMX2 pAb (ATL-HPA063763)
Atlas Antibodies
- Catalog No.:
- ATL-HPA063763-100
- Shipping:
- Calculated at Checkout
$638.00
Gene Name: TMX2
Alternative Gene Name: PDIA12, TXNDC14
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050043: 79%, ENSRNOG00000005308: 79%
Entrez Gene ID: 51075
Uniprot ID: Q9Y320
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ENVIREFNLNELYQRAKKLSKAGDNIPEEQPVASTPTTVSDGENKKDK |
| Gene Sequence | ENVIREFNLNELYQRAKKLSKAGDNIPEEQPVASTPTTVSDGENKKDK |
| Gene ID - Mouse | ENSMUSG00000050043 |
| Gene ID - Rat | ENSRNOG00000005308 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TMX2 pAb (ATL-HPA063763) | |
| Datasheet | Anti TMX2 pAb (ATL-HPA063763) Datasheet (External Link) |
| Vendor Page | Anti TMX2 pAb (ATL-HPA063763) at Atlas Antibodies |
| Documents & Links for Anti TMX2 pAb (ATL-HPA063763) | |
| Datasheet | Anti TMX2 pAb (ATL-HPA063763) Datasheet (External Link) |
| Vendor Page | Anti TMX2 pAb (ATL-HPA063763) |