Anti TMTC1 pAb (ATL-HPA016720)

Atlas Antibodies

Catalog No.:
ATL-HPA016720-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: transmembrane and tetratricopeptide repeat containing 1
Gene Name: TMTC1
Alternative Gene Name: ARG99, FLJ31400, FLJ41625, OLF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030306: 78%, ENSRNOG00000001854: 74%
Entrez Gene ID: 83857
Uniprot ID: Q8IUR5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GITVFGVCLVYDLFSLSNKQDKSSNGALCPRSPQQPGSPQPSSLPGHPHRENGKQQRFPHKGAWGGCHSPLPPEPKSSGFPVSPRAVWSMMR
Gene Sequence GITVFGVCLVYDLFSLSNKQDKSSNGALCPRSPQQPGSPQPSSLPGHPHRENGKQQRFPHKGAWGGCHSPLPPEPKSSGFPVSPRAVWSMMR
Gene ID - Mouse ENSMUSG00000030306
Gene ID - Rat ENSRNOG00000001854
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TMTC1 pAb (ATL-HPA016720)
Datasheet Anti TMTC1 pAb (ATL-HPA016720) Datasheet (External Link)
Vendor Page Anti TMTC1 pAb (ATL-HPA016720) at Atlas Antibodies

Documents & Links for Anti TMTC1 pAb (ATL-HPA016720)
Datasheet Anti TMTC1 pAb (ATL-HPA016720) Datasheet (External Link)
Vendor Page Anti TMTC1 pAb (ATL-HPA016720)