Anti TMPRSS9 pAb (ATL-HPA051483)

Atlas Antibodies

Catalog No.:
ATL-HPA051483-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: transmembrane protease, serine 9
Gene Name: TMPRSS9
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059406: 70%, ENSRNOG00000032429: 69%
Entrez Gene ID: 360200
Uniprot ID: Q7Z410
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LEEELLQRGIRARLREHGISLAAYGTIVSAELTGRHKGPLAERDFKSGRCPGNSFSCGNSQCVTKVNPECD
Gene Sequence LEEELLQRGIRARLREHGISLAAYGTIVSAELTGRHKGPLAERDFKSGRCPGNSFSCGNSQCVTKVNPECD
Gene ID - Mouse ENSMUSG00000059406
Gene ID - Rat ENSRNOG00000032429
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TMPRSS9 pAb (ATL-HPA051483)
Datasheet Anti TMPRSS9 pAb (ATL-HPA051483) Datasheet (External Link)
Vendor Page Anti TMPRSS9 pAb (ATL-HPA051483) at Atlas Antibodies

Documents & Links for Anti TMPRSS9 pAb (ATL-HPA051483)
Datasheet Anti TMPRSS9 pAb (ATL-HPA051483) Datasheet (External Link)
Vendor Page Anti TMPRSS9 pAb (ATL-HPA051483)