Anti TMPRSS9 pAb (ATL-HPA051483)
Atlas Antibodies
- Catalog No.:
- ATL-HPA051483-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: TMPRSS9
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059406: 70%, ENSRNOG00000032429: 69%
Entrez Gene ID: 360200
Uniprot ID: Q7Z410
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LEEELLQRGIRARLREHGISLAAYGTIVSAELTGRHKGPLAERDFKSGRCPGNSFSCGNSQCVTKVNPECD |
| Gene Sequence | LEEELLQRGIRARLREHGISLAAYGTIVSAELTGRHKGPLAERDFKSGRCPGNSFSCGNSQCVTKVNPECD |
| Gene ID - Mouse | ENSMUSG00000059406 |
| Gene ID - Rat | ENSRNOG00000032429 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TMPRSS9 pAb (ATL-HPA051483) | |
| Datasheet | Anti TMPRSS9 pAb (ATL-HPA051483) Datasheet (External Link) |
| Vendor Page | Anti TMPRSS9 pAb (ATL-HPA051483) at Atlas Antibodies |
| Documents & Links for Anti TMPRSS9 pAb (ATL-HPA051483) | |
| Datasheet | Anti TMPRSS9 pAb (ATL-HPA051483) Datasheet (External Link) |
| Vendor Page | Anti TMPRSS9 pAb (ATL-HPA051483) |