Anti TMPRSS9 pAb (ATL-HPA051483)
Atlas Antibodies
- Catalog No.:
- ATL-HPA051483-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: TMPRSS9
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059406: 70%, ENSRNOG00000032429: 69%
Entrez Gene ID: 360200
Uniprot ID: Q7Z410
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LEEELLQRGIRARLREHGISLAAYGTIVSAELTGRHKGPLAERDFKSGRCPGNSFSCGNSQCVTKVNPECD |
Gene Sequence | LEEELLQRGIRARLREHGISLAAYGTIVSAELTGRHKGPLAERDFKSGRCPGNSFSCGNSQCVTKVNPECD |
Gene ID - Mouse | ENSMUSG00000059406 |
Gene ID - Rat | ENSRNOG00000032429 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti TMPRSS9 pAb (ATL-HPA051483) | |
Datasheet | Anti TMPRSS9 pAb (ATL-HPA051483) Datasheet (External Link) |
Vendor Page | Anti TMPRSS9 pAb (ATL-HPA051483) at Atlas Antibodies |
Documents & Links for Anti TMPRSS9 pAb (ATL-HPA051483) | |
Datasheet | Anti TMPRSS9 pAb (ATL-HPA051483) Datasheet (External Link) |
Vendor Page | Anti TMPRSS9 pAb (ATL-HPA051483) |