Anti TMPRSS2 pAb (ATL-HPA035787 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA035787-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: transmembrane protease, serine 2
Gene Name: TMPRSS2
Alternative Gene Name: PRSS10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000385: 66%, ENSRNOG00000001976: 66%
Entrez Gene ID: 7113
Uniprot ID: O15393
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GSPPAIGPYYENHGYQPENPYPAQPTVVPTVYEVHPAQYYPSPVPQYAPRVLTQASNPVVCTQPKSPSGTVCTSKT
Gene Sequence GSPPAIGPYYENHGYQPENPYPAQPTVVPTVYEVHPAQYYPSPVPQYAPRVLTQASNPVVCTQPKSPSGTVCTSKT
Gene ID - Mouse ENSMUSG00000000385
Gene ID - Rat ENSRNOG00000001976
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TMPRSS2 pAb (ATL-HPA035787 w/enhanced validation)
Datasheet Anti TMPRSS2 pAb (ATL-HPA035787 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TMPRSS2 pAb (ATL-HPA035787 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti TMPRSS2 pAb (ATL-HPA035787 w/enhanced validation)
Datasheet Anti TMPRSS2 pAb (ATL-HPA035787 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TMPRSS2 pAb (ATL-HPA035787 w/enhanced validation)
Citations for Anti TMPRSS2 pAb (ATL-HPA035787 w/enhanced validation) – 14 Found
Colson, Arthur; Depoix, Christophe L; Dessilly, Géraldine; Baldin, Pamela; Danhaive, Olivier; Hubinont, Corinne; Sonveaux, Pierre; Debiève, Frédéric. Clinical and in Vitro Evidence against Placenta Infection at Term by Severe Acute Respiratory Syndrome Coronavirus 2. The American Journal Of Pathology. 2021;191(9):1610-1623.  PubMed
Rajah, Maaran Michael; Hubert, Mathieu; Bishop, Elodie; Saunders, Nell; Robinot, Remy; Grzelak, Ludivine; Planas, Delphine; Dufloo, Jérémy; Gellenoncourt, Stacy; Bongers, Alice; Zivaljic, Marija; Planchais, Cyril; Guivel-Benhassine, Florence; Porrot, Françoise; Mouquet, Hugo; Chakrabarti, Lisa A; Buchrieser, Julian; Schwartz, Olivier. SARS-CoV-2 Alpha, Beta, and Delta variants display enhanced Spike-mediated syncytia formation. The Embo Journal. 2021;40(24):e108944.  PubMed
Aguiar, Jennifer A; Tremblay, Benjamin J-M; Mansfield, Michael J; Woody, Owen; Lobb, Briallen; Banerjee, Arinjay; Chandiramohan, Abiram; Tiessen, Nicholas; Cao, Quynh; Dvorkin-Gheva, Anna; Revill, Spencer; Miller, Matthew S; Carlsten, Christopher; Organ, Louise; Joseph, Chitra; John, Alison; Hanson, Paul; Austin, Richard C; McManus, Bruce M; Jenkins, Gisli; Mossman, Karen; Ask, Kjetil; Doxey, Andrew C; Hirota, Jeremy A. Gene expression and in situ protein profiling of candidate SARS-CoV-2 receptors in human airway epithelial cells and lung tissue. The European Respiratory Journal. 2020;56(3)  PubMed
Buchrieser, Julian; Dufloo, Jérémy; Hubert, Mathieu; Monel, Blandine; Planas, Delphine; Rajah, Maaran Michael; Planchais, Cyril; Porrot, Françoise; Guivel-Benhassine, Florence; Van der Werf, Sylvie; Casartelli, Nicoletta; Mouquet, Hugo; Bruel, Timothée; Schwartz, Olivier. Syncytia formation by SARS-CoV-2-infected cells. The Embo Journal. 2020;39(23):e106267.  PubMed
Coate, Katie C; Cha, Jeeyeon; Shrestha, Shristi; Wang, Wenliang; Gonçalves, Luciana Mateus; Almaça, Joana; Kapp, Meghan E; Fasolino, Maria; Morgan, Ashleigh; Dai, Chunhua; Saunders, Diane C; Bottino, Rita; Aramandla, Radhika; Jenkins, Regina; Stein, Roland; Kaestner, Klaus H; Vahedi, Golnaz; Brissova, Marcela; Powers, Alvin C. SARS-CoV-2 Cell Entry Factors ACE2 and TMPRSS2 Are Expressed in the Microvasculature and Ducts of Human Pancreas but Are Not Enriched in β Cells. Cell Metabolism. 2020;32(6):1028-1040.e4.  PubMed
Jin, Ramon U; Brown, Jeffrey W; Li, Qing Kay; Bayguinov, Peter O; Wang, Jean S; Mills, Jason C. Tropism of Severe Acute Respiratory Syndrome Coronavirus 2 for Barrett's Esophagus May Increase Susceptibility to Developing Coronavirus Disease 2019. Gastroenterology. 2021;160(6):2165-2168.e4.  PubMed
Kwan, Jennifer Yin Yee; Lin, Liang-Tzung; Bell, Rachel; Bruce, Jeffrey P; Richardson, Christopher; Pugh, Trevor J; Liu, Fei-Fei. Elevation in viral entry genes and innate immunity compromise underlying increased infectivity and severity of COVID-19 in cancer patients. Scientific Reports. 2021;11(1):4533.  PubMed
Cecon, Erika; Burridge, Matilda; Cao, Longxing; Carter, Lauren; Ravichandran, Rashmi; Dam, Julie; Jockers, Ralf. SARS-COV-2 spike binding to ACE2 in living cells monitored by TR-FRET. Cell Chemical Biology. 2022;29(1):74-83.e4.  PubMed
Martin, Gottfried; Wolf, Julian; Lapp, Thabo; Agostini, Hansjürgen T; Schlunck, Günther; Auw-Hädrich, Claudia; Lange, Clemens A K. Viral S protein histochemistry reveals few potential SARS-CoV-2 entry sites in human ocular tissues. Scientific Reports. 2021;11(1):19140.  PubMed
Bräutigam, Konstantin; Reinhard, Stefan; Galván, José A; Wartenberg, Martin; Hewer, Ekkehard; Schürch, Christian M. Systematic Investigation of SARS-CoV-2 Receptor Protein Distribution along Viral Entry Routes in Humans. Respiration; International Review Of Thoracic Diseases. 101(6):610-618.  PubMed
Roelle, Sarah M; Shukla, Nidhi; Pham, Anh T; Bruchez, Anna M; Matreyek, Kenneth A. Expanded ACE2 dependencies of diverse SARS-like coronavirus receptor binding domains. Plos Biology. 2022;20(7):e3001738.  PubMed
Arefin, Samsul; Hernandez, Leah; Ward, Liam J; Schwarz, Angelina; Barany, Peter; Stenvinkel, Peter; Kublickiene, Karolina. Angiotensin-converting enzyme 2 and transmembrane protease serine 2 in female and male patients with end-stage kidney disease. European Journal Of Clinical Investigation. 2022;52(8):e13786.  PubMed
Fu, Jiewen; Liu, Shuguang; Tan, Qi; Liu, Zhiying; Qian, Jie; Li, Ting; Du, Jiaman; Song, Binghui; Li, Dabing; Zhang, Lianmei; He, Jiayue; Guo, Kan; Zhou, Baixu; Chen, Hanchun; Fu, Shangyi; Liu, Xiaoyan; Cheng, Jingliang; He, Tao; Fu, Junjiang. Impact of TMPRSS2 Expression, Mutation Prognostics, and Small Molecule (CD, AD, TQ, and TQFL12) Inhibition on Pan-Cancer Tumors and Susceptibility to SARS-CoV-2. Molecules (Basel, Switzerland). 2022;27(21)  PubMed
Planas, Delphine; Bruel, Timothée; Staropoli, Isabelle; Guivel-Benhassine, Florence; Porrot, Françoise; Maes, Piet; Grzelak, Ludivine; Prot, Matthieu; Mougari, Said; Planchais, Cyril; Puech, Julien; Saliba, Madelina; Sahraoui, Riwan; Fémy, Florent; Morel, Nathalie; Dufloo, Jérémy; Sanjuán, Rafael; Mouquet, Hugo; André, Emmanuel; Hocqueloux, Laurent; Simon-Loriere, Etienne; Veyer, David; Prazuck, Thierry; Péré, Hélène; Schwartz, Olivier. Resistance of Omicron subvariants BA.2.75.2, BA.4.6, and BQ.1.1 to neutralizing antibodies. Nature Communications. 2023;14(1):824.  PubMed