Anti TMPRSS15 pAb (ATL-HPA072934 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA072934-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: TMPRSS15
Alternative Gene Name: ENTK, MGC133046, PRSS7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022857: 64%, ENSRNOG00000001916: 57%
Entrez Gene ID: 5651
Uniprot ID: P98073
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LNDDNEWERIQGSTFSPFTGPNFDHTFGNASGFYISTPTGPGGRQERVGLLSLPLDPTLEPACLSFWYHMYGENVHKLSINISNDQNMEK |
| Gene Sequence | LNDDNEWERIQGSTFSPFTGPNFDHTFGNASGFYISTPTGPGGRQERVGLLSLPLDPTLEPACLSFWYHMYGENVHKLSINISNDQNMEK |
| Gene ID - Mouse | ENSMUSG00000022857 |
| Gene ID - Rat | ENSRNOG00000001916 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TMPRSS15 pAb (ATL-HPA072934 w/enhanced validation) | |
| Datasheet | Anti TMPRSS15 pAb (ATL-HPA072934 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti TMPRSS15 pAb (ATL-HPA072934 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti TMPRSS15 pAb (ATL-HPA072934 w/enhanced validation) | |
| Datasheet | Anti TMPRSS15 pAb (ATL-HPA072934 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti TMPRSS15 pAb (ATL-HPA072934 w/enhanced validation) |