Anti TMPRSS15 pAb (ATL-HPA015611 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA015611-25

Protein Description: transmembrane protease, serine 15
Gene Name: TMPRSS15
Alternative Gene Name: ENTK, MGC133046, PRSS7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022857: 75%, ENSRNOG00000001916: 69%
Entrez Gene ID: 5651
Uniprot ID: P98073
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: INDVVEIRDGEEADSLLLAVYTGPGPVKDVFSTTNRMTVLLITNDVLARGGFKANFTTGYHLGIPEPCKADHFQCKNGECVPLVNLCDGHLHCEDGSDEADCVRFFNGTTNNNGLVRFRIQSIWHTACAENWT
• Gene Sequence: INDVVEIRDGEEADSLLLAVYTGPGPVKDVFSTTNRMTVLLITNDVLARGGFKANFTTGYHLGIPEPCKADHFQCKNGECVPLVNLCDGHLHCEDGSDEADCVRFFNGTTNNNGLVRFRIQSIWHTACAENWT
• Gene ID - Mouse: ENSMUSG00000022857
• Gene ID - Rat: ENSRNOG00000001916
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TMPRSS15 pAb (ATL-HPA015611 w/enhanced validation) – 1 Found

Hayashi, Hideki; Kubo, Yoshinao; Izumida, Mai; Takahashi, Etsuhisa; Kido, Hiroshi; Sato, Ko; Yamaya, Mutsuo; Nishimura, Hidekazu; Nakayama, Kou; Matsuyama, Toshifumi. Enterokinase Enhances Influenza A Virus Infection by Activating Trypsinogen in Human Cell Lines. Frontiers In Cellular And Infection Microbiology. 8( 29629340):91.