Anti TMPRSS11F pAb (ATL-HPA026911)
Atlas Antibodies
- Catalog No.:
- ATL-HPA026911-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: TMPRSS11F
Alternative Gene Name: FLJ16046
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048764: 83%, ENSRNOG00000002005: 80%
Entrez Gene ID: 389208
Uniprot ID: Q6ZWK6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | NKDPTQWIATFGATITPPAVKRNVRKIILHENYHRETNENDIALVQLSTGVEFSNIVQRVCLPDSSIKLPPKTSVFVTGFGSIVDDGPIQNTLRQARVETISTDVCNRKDVYDG |
| Gene Sequence | NKDPTQWIATFGATITPPAVKRNVRKIILHENYHRETNENDIALVQLSTGVEFSNIVQRVCLPDSSIKLPPKTSVFVTGFGSIVDDGPIQNTLRQARVETISTDVCNRKDVYDG |
| Gene ID - Mouse | ENSMUSG00000048764 |
| Gene ID - Rat | ENSRNOG00000002005 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TMPRSS11F pAb (ATL-HPA026911) | |
| Datasheet | Anti TMPRSS11F pAb (ATL-HPA026911) Datasheet (External Link) |
| Vendor Page | Anti TMPRSS11F pAb (ATL-HPA026911) at Atlas Antibodies |
| Documents & Links for Anti TMPRSS11F pAb (ATL-HPA026911) | |
| Datasheet | Anti TMPRSS11F pAb (ATL-HPA026911) Datasheet (External Link) |
| Vendor Page | Anti TMPRSS11F pAb (ATL-HPA026911) |