Anti TMPRSS11F pAb (ATL-HPA026911)

Atlas Antibodies

Catalog No.:
ATL-HPA026911-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: transmembrane protease, serine 11F
Gene Name: TMPRSS11F
Alternative Gene Name: FLJ16046
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048764: 83%, ENSRNOG00000002005: 80%
Entrez Gene ID: 389208
Uniprot ID: Q6ZWK6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NKDPTQWIATFGATITPPAVKRNVRKIILHENYHRETNENDIALVQLSTGVEFSNIVQRVCLPDSSIKLPPKTSVFVTGFGSIVDDGPIQNTLRQARVETISTDVCNRKDVYDG
Gene Sequence NKDPTQWIATFGATITPPAVKRNVRKIILHENYHRETNENDIALVQLSTGVEFSNIVQRVCLPDSSIKLPPKTSVFVTGFGSIVDDGPIQNTLRQARVETISTDVCNRKDVYDG
Gene ID - Mouse ENSMUSG00000048764
Gene ID - Rat ENSRNOG00000002005
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TMPRSS11F pAb (ATL-HPA026911)
Datasheet Anti TMPRSS11F pAb (ATL-HPA026911) Datasheet (External Link)
Vendor Page Anti TMPRSS11F pAb (ATL-HPA026911) at Atlas Antibodies

Documents & Links for Anti TMPRSS11F pAb (ATL-HPA026911)
Datasheet Anti TMPRSS11F pAb (ATL-HPA026911) Datasheet (External Link)
Vendor Page Anti TMPRSS11F pAb (ATL-HPA026911)