Anti TMPRSS11D pAb (ATL-HPA052834)

Atlas Antibodies

Catalog No.:
ATL-HPA052834-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: transmembrane protease, serine 11D
Gene Name: TMPRSS11D
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061259: 64%, ENSRNOG00000055991: 65%
Entrez Gene ID: 9407
Uniprot ID: O60235
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KFQFTRNNNGASMKSRIESVLRQMLNNSGNLEINPSTEITSLTDQAAANWLINECGAGPDLITLSEQRILGGTEAEEG
Gene Sequence KFQFTRNNNGASMKSRIESVLRQMLNNSGNLEINPSTEITSLTDQAAANWLINECGAGPDLITLSEQRILGGTEAEEG
Gene ID - Mouse ENSMUSG00000061259
Gene ID - Rat ENSRNOG00000055991
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TMPRSS11D pAb (ATL-HPA052834)
Datasheet Anti TMPRSS11D pAb (ATL-HPA052834) Datasheet (External Link)
Vendor Page Anti TMPRSS11D pAb (ATL-HPA052834) at Atlas Antibodies

Documents & Links for Anti TMPRSS11D pAb (ATL-HPA052834)
Datasheet Anti TMPRSS11D pAb (ATL-HPA052834) Datasheet (External Link)
Vendor Page Anti TMPRSS11D pAb (ATL-HPA052834)
Citations for Anti TMPRSS11D pAb (ATL-HPA052834) – 2 Found
Duhaime, Michael J; Page, Khaliph O; Varela, Fausto A; Murray, Andrew S; Silverman, Michael E; Zoratti, Gina L; List, Karin. Cell Surface Human Airway Trypsin-Like Protease Is Lost During Squamous Cell Carcinogenesis. Journal Of Cellular Physiology. 2016;231(7):1476-83.  PubMed
Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476.  PubMed