Anti TMPRSS11D pAb (ATL-HPA052834)

Atlas Antibodies

Catalog No.: ATL-HPA052834-25

Protein Description: transmembrane protease, serine 11D
Gene Name: TMPRSS11D
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061259: 64%, ENSRNOG00000055991: 65%
Entrez Gene ID: 9407
Uniprot ID: O60235
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KFQFTRNNNGASMKSRIESVLRQMLNNSGNLEINPSTEITSLTDQAAANWLINECGAGPDLITLSEQRILGGTEAEEG
• Gene Sequence: KFQFTRNNNGASMKSRIESVLRQMLNNSGNLEINPSTEITSLTDQAAANWLINECGAGPDLITLSEQRILGGTEAEEG
• Gene ID - Mouse: ENSMUSG00000061259
• Gene ID - Rat: ENSRNOG00000055991
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TMPRSS11D pAb (ATL-HPA052834) – 2 Found

Duhaime, Michael J; Page, Khaliph O; Varela, Fausto A; Murray, Andrew S; Silverman, Michael E; Zoratti, Gina L; List, Karin. Cell Surface Human Airway Trypsin-Like Protease Is Lost During Squamous Cell Carcinogenesis. Journal Of Cellular Physiology. 2016;231(7):1476-83. 

Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476.