Anti TMPRSS11A pAb (ATL-HPA078316)

Atlas Antibodies

Catalog No.:
ATL-HPA078316-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: transmembrane serine protease 11A
Gene Name: TMPRSS11A
Alternative Gene Name: ECRG1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000072845: 60%, ENSRNOG00000046764: 58%
Entrez Gene ID: 339967
Uniprot ID: Q6ZMR5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FIDSAWKKNYIKNQVVRLTPEEDGVKVDVIMVFQFPSTEQRAVREKKIQSILNQKIR
Gene Sequence FIDSAWKKNYIKNQVVRLTPEEDGVKVDVIMVFQFPSTEQRAVREKKIQSILNQKIR
Gene ID - Mouse ENSMUSG00000072845
Gene ID - Rat ENSRNOG00000046764
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TMPRSS11A pAb (ATL-HPA078316)
Datasheet Anti TMPRSS11A pAb (ATL-HPA078316) Datasheet (External Link)
Vendor Page Anti TMPRSS11A pAb (ATL-HPA078316) at Atlas Antibodies

Documents & Links for Anti TMPRSS11A pAb (ATL-HPA078316)
Datasheet Anti TMPRSS11A pAb (ATL-HPA078316) Datasheet (External Link)
Vendor Page Anti TMPRSS11A pAb (ATL-HPA078316)