Anti TMPRSS11A pAb (ATL-HPA078316)
Atlas Antibodies
- SKU:
- ATL-HPA078316-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: TMPRSS11A
Alternative Gene Name: ECRG1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000072845: 60%, ENSRNOG00000046764: 58%
Entrez Gene ID: 339967
Uniprot ID: Q6ZMR5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | FIDSAWKKNYIKNQVVRLTPEEDGVKVDVIMVFQFPSTEQRAVREKKIQSILNQKIR |
Gene Sequence | FIDSAWKKNYIKNQVVRLTPEEDGVKVDVIMVFQFPSTEQRAVREKKIQSILNQKIR |
Gene ID - Mouse | ENSMUSG00000072845 |
Gene ID - Rat | ENSRNOG00000046764 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti TMPRSS11A pAb (ATL-HPA078316) | |
Datasheet | Anti TMPRSS11A pAb (ATL-HPA078316) Datasheet (External Link) |
Vendor Page | Anti TMPRSS11A pAb (ATL-HPA078316) at Atlas Antibodies |
Documents & Links for Anti TMPRSS11A pAb (ATL-HPA078316) | |
Datasheet | Anti TMPRSS11A pAb (ATL-HPA078316) Datasheet (External Link) |
Vendor Page | Anti TMPRSS11A pAb (ATL-HPA078316) |