Anti TMPO pAb (ATL-HPA070805)

Atlas Antibodies

Catalog No.:
ATL-HPA070805-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: thymopoietin
Gene Name: TMPO
Alternative Gene Name: LAP2, LEMD4, TP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019961: 89%, ENSRNOG00000008797: 88%
Entrez Gene ID: 7112
Uniprot ID: P42167
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IDGPVISESTPIAETIMASSNESLVVNRVTGNFKHASPILPITEFSDIPRRAPKKPLTRAEVGEKTEERRVERDIL
Gene Sequence IDGPVISESTPIAETIMASSNESLVVNRVTGNFKHASPILPITEFSDIPRRAPKKPLTRAEVGEKTEERRVERDIL
Gene ID - Mouse ENSMUSG00000019961
Gene ID - Rat ENSRNOG00000008797
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TMPO pAb (ATL-HPA070805)
Datasheet Anti TMPO pAb (ATL-HPA070805) Datasheet (External Link)
Vendor Page Anti TMPO pAb (ATL-HPA070805) at Atlas Antibodies

Documents & Links for Anti TMPO pAb (ATL-HPA070805)
Datasheet Anti TMPO pAb (ATL-HPA070805) Datasheet (External Link)
Vendor Page Anti TMPO pAb (ATL-HPA070805)