Anti TMPO pAb (ATL-HPA070805)
Atlas Antibodies
- Catalog No.:
- ATL-HPA070805-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: TMPO
Alternative Gene Name: LAP2, LEMD4, TP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019961: 89%, ENSRNOG00000008797: 88%
Entrez Gene ID: 7112
Uniprot ID: P42167
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | IDGPVISESTPIAETIMASSNESLVVNRVTGNFKHASPILPITEFSDIPRRAPKKPLTRAEVGEKTEERRVERDIL |
Gene Sequence | IDGPVISESTPIAETIMASSNESLVVNRVTGNFKHASPILPITEFSDIPRRAPKKPLTRAEVGEKTEERRVERDIL |
Gene ID - Mouse | ENSMUSG00000019961 |
Gene ID - Rat | ENSRNOG00000008797 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti TMPO pAb (ATL-HPA070805) | |
Datasheet | Anti TMPO pAb (ATL-HPA070805) Datasheet (External Link) |
Vendor Page | Anti TMPO pAb (ATL-HPA070805) at Atlas Antibodies |
Documents & Links for Anti TMPO pAb (ATL-HPA070805) | |
Datasheet | Anti TMPO pAb (ATL-HPA070805) Datasheet (External Link) |
Vendor Page | Anti TMPO pAb (ATL-HPA070805) |