Anti TMF1 pAb (ATL-HPA008729 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA008729-25

Protein Description: TATA element modulatory factor 1
Gene Name: TMF1
Alternative Gene Name: ARA160, TMF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030059: 87%, ENSRNOG00000056462: 84%
Entrez Gene ID: 7110
Uniprot ID: P82094
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TSTTSDIEVLDHESVISESSASSRQETTDSKSSLHLMQTSFQLLSASACPEYNRLDDFQKLTESCCSSDAFERIDSFSVQSLDSRSVSEINSDDELSGKGYALVPIIVNSSTPKSKTVESAEGKSEEVNETLVIPTEEAEMEESG
• Gene Sequence: TSTTSDIEVLDHESVISESSASSRQETTDSKSSLHLMQTSFQLLSASACPEYNRLDDFQKLTESCCSSDAFERIDSFSVQSLDSRSVSEINSDDELSGKGYALVPIIVNSSTPKSKTVESAEGKSEEVNETLVIPTEEAEMEESG
• Gene ID - Mouse: ENSMUSG00000030059
• Gene ID - Rat: ENSRNOG00000056462
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TMF1 pAb (ATL-HPA008729 w/enhanced validation) – 5 Found

Wong, Mie; Gillingham, Alison K; Munro, Sean. The golgin coiled-coil proteins capture different types of transport carriers via distinct N-terminal motifs. Bmc Biology. 2017;15(1):3. 

Bel, Shai; Elkis, Yoav; Lerer-Goldstein, Tali; Nyska, Abraham; Shpungin, Sally; Nir, Uri. Loss of TMF/ARA160 protein renders colonic mucus refractory to bacterial colonization and diminishes intestinal susceptibility to acute colitis. The Journal Of Biological Chemistry. 2012;287(30):25631-9. 

Arabi, Azadeh; Ullah, Karim; Branca, Rui M M; Johansson, Johan; Bandarra, Daniel; Haneklaus, Moritz; Fu, Jing; Ariës, Ingrid; Nilsson, Peter; Den Boer, Monique L; Pokrovskaja, Katja; Grandér, Dan; Xiao, Gutian; Rocha, Sonia; Lehtiö, Janne; Sangfelt, Olle. Proteomic screen reveals Fbw7 as a modulator of the NF-κB pathway. Nature Communications. 3( 22864569):976. 

Wong, Mie; Munro, Sean. Membrane trafficking. The specificity of vesicle traffic to the Golgi is encoded in the golgin coiled-coil proteins. Science (New York, N.y.). 2014;346(6209):1256898. 

Ishida, Morié; Bonifacino, Juan S. ARFRP1 functions upstream of ARL1 and ARL5 to coordinate recruitment of distinct tethering factors to the trans-Golgi network. The Journal Of Cell Biology. 2019;218(11):3681-3696.