Anti TMEM97 pAb (ATL-HPA076689 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA076689-25

• 
• 
• 

Protein Description: transmembrane protein 97
Gene Name: TMEM97
Alternative Gene Name: MAC30
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037278: 82%, ENSRNOG00000022657: 79%
Entrez Gene ID: 27346
Uniprot ID: Q5BJF2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DLQAVLPRELYPVEFRNLLKWYAKEFKDPLLQEPPAWFK
• Gene Sequence: DLQAVLPRELYPVEFRNLLKWYAKEFKDPLLQEPPAWFK
• Gene ID - Mouse: ENSMUSG00000037278
• Gene ID - Rat: ENSRNOG00000022657
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.