Anti TMEM92 pAb (ATL-HPA069820)

Atlas Antibodies

Catalog No.:
ATL-HPA069820-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: transmembrane protein 92
Gene Name: TMEM92
Alternative Gene Name: FLJ33318
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025020: 38%, ENSRNOG00000026065: 38%
Entrez Gene ID: 162461
Uniprot ID: Q6UXU6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AKCGLILACPKGFKCCGDSCCQENELFPGPVRIF
Gene Sequence AKCGLILACPKGFKCCGDSCCQENELFPGPVRIF
Gene ID - Mouse ENSMUSG00000025020
Gene ID - Rat ENSRNOG00000026065
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TMEM92 pAb (ATL-HPA069820)
Datasheet Anti TMEM92 pAb (ATL-HPA069820) Datasheet (External Link)
Vendor Page Anti TMEM92 pAb (ATL-HPA069820) at Atlas Antibodies

Documents & Links for Anti TMEM92 pAb (ATL-HPA069820)
Datasheet Anti TMEM92 pAb (ATL-HPA069820) Datasheet (External Link)
Vendor Page Anti TMEM92 pAb (ATL-HPA069820)