Anti TMEM92 pAb (ATL-HPA069820)
Atlas Antibodies
- Catalog No.:
- ATL-HPA069820-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: TMEM92
Alternative Gene Name: FLJ33318
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025020: 38%, ENSRNOG00000026065: 38%
Entrez Gene ID: 162461
Uniprot ID: Q6UXU6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | AKCGLILACPKGFKCCGDSCCQENELFPGPVRIF |
Gene Sequence | AKCGLILACPKGFKCCGDSCCQENELFPGPVRIF |
Gene ID - Mouse | ENSMUSG00000025020 |
Gene ID - Rat | ENSRNOG00000026065 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti TMEM92 pAb (ATL-HPA069820) | |
Datasheet | Anti TMEM92 pAb (ATL-HPA069820) Datasheet (External Link) |
Vendor Page | Anti TMEM92 pAb (ATL-HPA069820) at Atlas Antibodies |
Documents & Links for Anti TMEM92 pAb (ATL-HPA069820) | |
Datasheet | Anti TMEM92 pAb (ATL-HPA069820) Datasheet (External Link) |
Vendor Page | Anti TMEM92 pAb (ATL-HPA069820) |