Anti TMEM92 pAb (ATL-HPA063009)

Atlas Antibodies

Catalog No.:
ATL-HPA063009-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: transmembrane protein 92
Gene Name: TMEM92
Alternative Gene Name: FLJ33318
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000075610: 53%, ENSRNOG00000042868: 53%
Entrez Gene ID: 162461
Uniprot ID: Q6UXU6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ELPSIIPPERVRVSLSAPPPPYSEVILKPSLGPTPTEPPPPYSFRPEEYTGDQ
Gene Sequence ELPSIIPPERVRVSLSAPPPPYSEVILKPSLGPTPTEPPPPYSFRPEEYTGDQ
Gene ID - Mouse ENSMUSG00000075610
Gene ID - Rat ENSRNOG00000042868
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TMEM92 pAb (ATL-HPA063009)
Datasheet Anti TMEM92 pAb (ATL-HPA063009) Datasheet (External Link)
Vendor Page Anti TMEM92 pAb (ATL-HPA063009) at Atlas Antibodies

Documents & Links for Anti TMEM92 pAb (ATL-HPA063009)
Datasheet Anti TMEM92 pAb (ATL-HPA063009) Datasheet (External Link)
Vendor Page Anti TMEM92 pAb (ATL-HPA063009)