Anti TMEM8B pAb (ATL-HPA052130)
Atlas Antibodies
- Catalog No.:
- ATL-HPA052130-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: TMEM8B
Alternative Gene Name: C9orf127, NAG-5, NGX6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078716: 90%, ENSRNOG00000015664: 89%
Entrez Gene ID: 51754
Uniprot ID: A6NDV4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MNMPQSLGNQPLPPEPPSLGTPAEGPGTTSPPEHCWPVRPTLRNELDTFSVHFYIFFGPSVALPPERPAVFAMRLLPVLD |
Gene Sequence | MNMPQSLGNQPLPPEPPSLGTPAEGPGTTSPPEHCWPVRPTLRNELDTFSVHFYIFFGPSVALPPERPAVFAMRLLPVLD |
Gene ID - Mouse | ENSMUSG00000078716 |
Gene ID - Rat | ENSRNOG00000015664 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti TMEM8B pAb (ATL-HPA052130) | |
Datasheet | Anti TMEM8B pAb (ATL-HPA052130) Datasheet (External Link) |
Vendor Page | Anti TMEM8B pAb (ATL-HPA052130) at Atlas Antibodies |
Documents & Links for Anti TMEM8B pAb (ATL-HPA052130) | |
Datasheet | Anti TMEM8B pAb (ATL-HPA052130) Datasheet (External Link) |
Vendor Page | Anti TMEM8B pAb (ATL-HPA052130) |