Anti TMEM8A pAb (ATL-HPA051281)

Atlas Antibodies

Catalog No.:
ATL-HPA051281-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: transmembrane protein 8A
Gene Name: TMEM8A
Alternative Gene Name: M83, TMEM6, TMEM8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024180: 73%, ENSRNOG00000020374: 75%
Entrez Gene ID: 58986
Uniprot ID: Q9HCN3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TCAYVFQPELLVTRVVEISIMEPDVPLPQTLLSHPSYLKVFVPDYTRELLLELRDCVSNGSLGCPVRLTVGPVTLPSNFQKVL
Gene Sequence TCAYVFQPELLVTRVVEISIMEPDVPLPQTLLSHPSYLKVFVPDYTRELLLELRDCVSNGSLGCPVRLTVGPVTLPSNFQKVL
Gene ID - Mouse ENSMUSG00000024180
Gene ID - Rat ENSRNOG00000020374
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TMEM8A pAb (ATL-HPA051281)
Datasheet Anti TMEM8A pAb (ATL-HPA051281) Datasheet (External Link)
Vendor Page Anti TMEM8A pAb (ATL-HPA051281) at Atlas Antibodies

Documents & Links for Anti TMEM8A pAb (ATL-HPA051281)
Datasheet Anti TMEM8A pAb (ATL-HPA051281) Datasheet (External Link)
Vendor Page Anti TMEM8A pAb (ATL-HPA051281)