Anti TMEM8A pAb (ATL-HPA051281)

Atlas Antibodies

Catalog No.: ATL-HPA051281-25

Protein Description: transmembrane protein 8A
Gene Name: TMEM8A
Alternative Gene Name: M83, TMEM6, TMEM8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024180: 73%, ENSRNOG00000020374: 75%
Entrez Gene ID: 58986
Uniprot ID: Q9HCN3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TCAYVFQPELLVTRVVEISIMEPDVPLPQTLLSHPSYLKVFVPDYTRELLLELRDCVSNGSLGCPVRLTVGPVTLPSNFQKVL
• Gene Sequence: TCAYVFQPELLVTRVVEISIMEPDVPLPQTLLSHPSYLKVFVPDYTRELLLELRDCVSNGSLGCPVRLTVGPVTLPSNFQKVL
• Gene ID - Mouse: ENSMUSG00000024180
• Gene ID - Rat: ENSRNOG00000020374
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.