Anti TMEM89 pAb (ATL-HPA053577)

Atlas Antibodies

Catalog No.:
ATL-HPA053577-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: transmembrane protein 89
Gene Name: TMEM89
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000107174: 59%, ENSRNOG00000031141: 72%
Entrez Gene ID: 440955
Uniprot ID: A2RUT3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RPLWYQVGLDLQPWGCQPKSVEGCRGGLSCPGYWLGPGA
Gene Sequence RPLWYQVGLDLQPWGCQPKSVEGCRGGLSCPGYWLGPGA
Gene ID - Mouse ENSMUSG00000107174
Gene ID - Rat ENSRNOG00000031141
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TMEM89 pAb (ATL-HPA053577)
Datasheet Anti TMEM89 pAb (ATL-HPA053577) Datasheet (External Link)
Vendor Page Anti TMEM89 pAb (ATL-HPA053577) at Atlas Antibodies

Documents & Links for Anti TMEM89 pAb (ATL-HPA053577)
Datasheet Anti TMEM89 pAb (ATL-HPA053577) Datasheet (External Link)
Vendor Page Anti TMEM89 pAb (ATL-HPA053577)