Anti TMEM71 pAb (ATL-HPA070655)
Atlas Antibodies
- Catalog No.:
- ATL-HPA070655-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: TMEM71
Alternative Gene Name: FLJ33069
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036944: 79%, ENSRNOG00000025460: 69%
Entrez Gene ID: 137835
Uniprot ID: Q6P5X7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MSTPVASSSRLEREYAGELSPTCIFPSFTCDSLDGYHSFECGSIDPLTGSHYTCRRSPRLLTNGYYIWTED |
Gene Sequence | MSTPVASSSRLEREYAGELSPTCIFPSFTCDSLDGYHSFECGSIDPLTGSHYTCRRSPRLLTNGYYIWTED |
Gene ID - Mouse | ENSMUSG00000036944 |
Gene ID - Rat | ENSRNOG00000025460 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti TMEM71 pAb (ATL-HPA070655) | |
Datasheet | Anti TMEM71 pAb (ATL-HPA070655) Datasheet (External Link) |
Vendor Page | Anti TMEM71 pAb (ATL-HPA070655) at Atlas Antibodies |
Documents & Links for Anti TMEM71 pAb (ATL-HPA070655) | |
Datasheet | Anti TMEM71 pAb (ATL-HPA070655) Datasheet (External Link) |
Vendor Page | Anti TMEM71 pAb (ATL-HPA070655) |