Anti TMEM71 pAb (ATL-HPA070655)

Atlas Antibodies

Catalog No.:
ATL-HPA070655-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: transmembrane protein 71
Gene Name: TMEM71
Alternative Gene Name: FLJ33069
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036944: 79%, ENSRNOG00000025460: 69%
Entrez Gene ID: 137835
Uniprot ID: Q6P5X7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MSTPVASSSRLEREYAGELSPTCIFPSFTCDSLDGYHSFECGSIDPLTGSHYTCRRSPRLLTNGYYIWTED
Gene Sequence MSTPVASSSRLEREYAGELSPTCIFPSFTCDSLDGYHSFECGSIDPLTGSHYTCRRSPRLLTNGYYIWTED
Gene ID - Mouse ENSMUSG00000036944
Gene ID - Rat ENSRNOG00000025460
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TMEM71 pAb (ATL-HPA070655)
Datasheet Anti TMEM71 pAb (ATL-HPA070655) Datasheet (External Link)
Vendor Page Anti TMEM71 pAb (ATL-HPA070655) at Atlas Antibodies

Documents & Links for Anti TMEM71 pAb (ATL-HPA070655)
Datasheet Anti TMEM71 pAb (ATL-HPA070655) Datasheet (External Link)
Vendor Page Anti TMEM71 pAb (ATL-HPA070655)