Anti TMEM71 pAb (ATL-HPA058401)

Atlas Antibodies

SKU:
ATL-HPA058401-25
  • Immunohistochemical staining of human colon shows moderate cytoplasmic positivity in glandular cells.
  • Immunofluorescent staining of human cell line RH-30 shows localization to mitochondria.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: transmembrane protein 71
Gene Name: TMEM71
Alternative Gene Name: FLJ33069
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036944: 43%, ENSRNOG00000025460: 40%
Entrez Gene ID: 137835
Uniprot ID: Q6P5X7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SLTDDWESGKMNAESVITSSSSHIISQPPGGNSHSLSLQSQLTASERFQENSSDHSETRLLQE
Gene Sequence SLTDDWESGKMNAESVITSSSSHIISQPPGGNSHSLSLQSQLTASERFQENSSDHSETRLLQE
Gene ID - Mouse ENSMUSG00000036944
Gene ID - Rat ENSRNOG00000025460
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti TMEM71 pAb (ATL-HPA058401)
Datasheet Anti TMEM71 pAb (ATL-HPA058401) Datasheet (External Link)
Vendor Page Anti TMEM71 pAb (ATL-HPA058401) at Atlas Antibodies

Documents & Links for Anti TMEM71 pAb (ATL-HPA058401)
Datasheet Anti TMEM71 pAb (ATL-HPA058401) Datasheet (External Link)
Vendor Page Anti TMEM71 pAb (ATL-HPA058401)