Anti TMEM65 pAb (ATL-HPA025020)
Atlas Antibodies
- Catalog No.:
- ATL-HPA025020-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: TMEM65
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062373: 98%, ENSRNOG00000008934: 81%
Entrez Gene ID: 157378
Uniprot ID: Q6PI78
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EALNTAQGARDFIYSLHSTERSCLLKELHRFESIAIAQEKLEAPPPT |
| Gene Sequence | EALNTAQGARDFIYSLHSTERSCLLKELHRFESIAIAQEKLEAPPPT |
| Gene ID - Mouse | ENSMUSG00000062373 |
| Gene ID - Rat | ENSRNOG00000008934 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TMEM65 pAb (ATL-HPA025020) | |
| Datasheet | Anti TMEM65 pAb (ATL-HPA025020) Datasheet (External Link) |
| Vendor Page | Anti TMEM65 pAb (ATL-HPA025020) at Atlas Antibodies |
| Documents & Links for Anti TMEM65 pAb (ATL-HPA025020) | |
| Datasheet | Anti TMEM65 pAb (ATL-HPA025020) Datasheet (External Link) |
| Vendor Page | Anti TMEM65 pAb (ATL-HPA025020) |
| Citations for Anti TMEM65 pAb (ATL-HPA025020) – 1 Found |
| Kallabis, Sebastian; Abraham, Lena; Müller, Stefan; Dzialas, Verena; Türk, Clara; Wiederstein, Janica Lea; Bock, Theresa; Nolte, Hendrik; Nogara, Leonardo; Blaauw, Bert; Braun, Thomas; Krüger, Marcus. High-throughput proteomics fiber typing (ProFiT) for comprehensive characterization of single skeletal muscle fibers. Skeletal Muscle. 2020;10(1):7. PubMed |