Anti TMEM65 pAb (ATL-HPA025020)

Atlas Antibodies

Catalog No.:
ATL-HPA025020-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: transmembrane protein 65
Gene Name: TMEM65
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062373: 98%, ENSRNOG00000008934: 81%
Entrez Gene ID: 157378
Uniprot ID: Q6PI78
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EALNTAQGARDFIYSLHSTERSCLLKELHRFESIAIAQEKLEAPPPT
Gene Sequence EALNTAQGARDFIYSLHSTERSCLLKELHRFESIAIAQEKLEAPPPT
Gene ID - Mouse ENSMUSG00000062373
Gene ID - Rat ENSRNOG00000008934
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TMEM65 pAb (ATL-HPA025020)
Datasheet Anti TMEM65 pAb (ATL-HPA025020) Datasheet (External Link)
Vendor Page Anti TMEM65 pAb (ATL-HPA025020) at Atlas Antibodies

Documents & Links for Anti TMEM65 pAb (ATL-HPA025020)
Datasheet Anti TMEM65 pAb (ATL-HPA025020) Datasheet (External Link)
Vendor Page Anti TMEM65 pAb (ATL-HPA025020)
Citations for Anti TMEM65 pAb (ATL-HPA025020) – 1 Found
Kallabis, Sebastian; Abraham, Lena; Müller, Stefan; Dzialas, Verena; Türk, Clara; Wiederstein, Janica Lea; Bock, Theresa; Nolte, Hendrik; Nogara, Leonardo; Blaauw, Bert; Braun, Thomas; Krüger, Marcus. High-throughput proteomics fiber typing (ProFiT) for comprehensive characterization of single skeletal muscle fibers. Skeletal Muscle. 2020;10(1):7.  PubMed