Anti TMEM63B pAb (ATL-HPA029251)

Atlas Antibodies

Catalog No.: ATL-HPA029251-25

Protein Description: transmembrane protein 63B
Gene Name: TMEM63B
Alternative Gene Name: C6orf110, dJ421H19.2, DKFZp434P0531
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036026: 96%, ENSRNOG00000019743: 96%
Entrez Gene ID: 55362
Uniprot ID: Q5T3F8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SKENVPTMINPKPCGHLCCCVVRGCEQVEAIEYYTKLEQKLKEDYKREKEKVNEKPLGMAFVTFHNETITAIILKDFNVCKCQGC
• Gene Sequence: SKENVPTMINPKPCGHLCCCVVRGCEQVEAIEYYTKLEQKLKEDYKREKEKVNEKPLGMAFVTFHNETITAIILKDFNVCKCQGC
• Gene ID - Mouse: ENSMUSG00000036026
• Gene ID - Rat: ENSRNOG00000019743
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.