Anti TMEM63B pAb (ATL-HPA029249)
Atlas Antibodies
- Catalog No.:
- ATL-HPA029249-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: TMEM63B
Alternative Gene Name: C6orf110, dJ421H19.2, DKFZp434P0531
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036026: 100%, ENSRNOG00000019743: 100%
Entrez Gene ID: 55362
Uniprot ID: Q5T3F8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RTLFINGISKYAESEKIKKHFEEAYPNCTVLEARPCYNVARLMFLDAERKKAERGKLYFTN |
| Gene Sequence | RTLFINGISKYAESEKIKKHFEEAYPNCTVLEARPCYNVARLMFLDAERKKAERGKLYFTN |
| Gene ID - Mouse | ENSMUSG00000036026 |
| Gene ID - Rat | ENSRNOG00000019743 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TMEM63B pAb (ATL-HPA029249) | |
| Datasheet | Anti TMEM63B pAb (ATL-HPA029249) Datasheet (External Link) |
| Vendor Page | Anti TMEM63B pAb (ATL-HPA029249) at Atlas Antibodies |
| Documents & Links for Anti TMEM63B pAb (ATL-HPA029249) | |
| Datasheet | Anti TMEM63B pAb (ATL-HPA029249) Datasheet (External Link) |
| Vendor Page | Anti TMEM63B pAb (ATL-HPA029249) |