Anti TMEM63B pAb (ATL-HPA029249)

Atlas Antibodies

Catalog No.:
ATL-HPA029249-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: transmembrane protein 63B
Gene Name: TMEM63B
Alternative Gene Name: C6orf110, dJ421H19.2, DKFZp434P0531
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036026: 100%, ENSRNOG00000019743: 100%
Entrez Gene ID: 55362
Uniprot ID: Q5T3F8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RTLFINGISKYAESEKIKKHFEEAYPNCTVLEARPCYNVARLMFLDAERKKAERGKLYFTN
Gene Sequence RTLFINGISKYAESEKIKKHFEEAYPNCTVLEARPCYNVARLMFLDAERKKAERGKLYFTN
Gene ID - Mouse ENSMUSG00000036026
Gene ID - Rat ENSRNOG00000019743
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TMEM63B pAb (ATL-HPA029249)
Datasheet Anti TMEM63B pAb (ATL-HPA029249) Datasheet (External Link)
Vendor Page Anti TMEM63B pAb (ATL-HPA029249) at Atlas Antibodies

Documents & Links for Anti TMEM63B pAb (ATL-HPA029249)
Datasheet Anti TMEM63B pAb (ATL-HPA029249) Datasheet (External Link)
Vendor Page Anti TMEM63B pAb (ATL-HPA029249)