Anti TMEM63A pAb (ATL-HPA068918)

Atlas Antibodies

SKU:
ATL-HPA068918-25
  • Immunofluorescent staining of human cell line RT4 shows localization to microtubule organizing center & vesicles.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: transmembrane protein 63A
Gene Name: TMEM63A
Alternative Gene Name: KIAA0792
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026519: 90%, ENSRNOG00000003310: 90%
Entrez Gene ID: 9725
Uniprot ID: O94886
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TQSIKYKEENLVRRTLFITGLPRDARKETVESHFRDAYPTCEVVDVQLCYNVAKLIYLCKEKKKTEKSLTYYTNLQVKTGQRTLINPKPCGQFCCCEVLGC
Gene Sequence TQSIKYKEENLVRRTLFITGLPRDARKETVESHFRDAYPTCEVVDVQLCYNVAKLIYLCKEKKKTEKSLTYYTNLQVKTGQRTLINPKPCGQFCCCEVLGC
Gene ID - Mouse ENSMUSG00000026519
Gene ID - Rat ENSRNOG00000003310
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti TMEM63A pAb (ATL-HPA068918)
Datasheet Anti TMEM63A pAb (ATL-HPA068918) Datasheet (External Link)
Vendor Page Anti TMEM63A pAb (ATL-HPA068918) at Atlas Antibodies

Documents & Links for Anti TMEM63A pAb (ATL-HPA068918)
Datasheet Anti TMEM63A pAb (ATL-HPA068918) Datasheet (External Link)
Vendor Page Anti TMEM63A pAb (ATL-HPA068918)