Anti TMEM63A pAb (ATL-HPA066504)
Atlas Antibodies
- Catalog No.:
- ATL-HPA066504-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: TMEM63A
Alternative Gene Name: KIAA0792
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026519: 94%, ENSRNOG00000003310: 85%
Entrez Gene ID: 9725
Uniprot ID: O94886
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | FKHLSPLNYKTEEPASDKGSEAEAHMPPPFTPYVPRILNGLASERTAL |
Gene Sequence | FKHLSPLNYKTEEPASDKGSEAEAHMPPPFTPYVPRILNGLASERTAL |
Gene ID - Mouse | ENSMUSG00000026519 |
Gene ID - Rat | ENSRNOG00000003310 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti TMEM63A pAb (ATL-HPA066504) | |
Datasheet | Anti TMEM63A pAb (ATL-HPA066504) Datasheet (External Link) |
Vendor Page | Anti TMEM63A pAb (ATL-HPA066504) at Atlas Antibodies |
Documents & Links for Anti TMEM63A pAb (ATL-HPA066504) | |
Datasheet | Anti TMEM63A pAb (ATL-HPA066504) Datasheet (External Link) |
Vendor Page | Anti TMEM63A pAb (ATL-HPA066504) |