Anti TMEM62 pAb (ATL-HPA062359)

Atlas Antibodies

SKU:
ATL-HPA062359-25
  • Immunofluorescent staining of human cell line A-431 shows localization to nucleus, nuclear bodies, nucleoli fibrillar center & cytoplasmic bodies.
  • Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: transmembrane protein 62
Gene Name: TMEM62
Alternative Gene Name: FLJ23375
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054484: 90%, ENSRNOG00000023874: 87%
Entrez Gene ID: 80021
Uniprot ID: Q0P6H9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LHTRHFQGTLELEVGDWKDNRRYRIFAFDHDLFSFADLIFGKWPVVLITNPKSLLYSCGEHEPLERLLHST
Gene Sequence LHTRHFQGTLELEVGDWKDNRRYRIFAFDHDLFSFADLIFGKWPVVLITNPKSLLYSCGEHEPLERLLHST
Gene ID - Mouse ENSMUSG00000054484
Gene ID - Rat ENSRNOG00000023874
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti TMEM62 pAb (ATL-HPA062359)
Datasheet Anti TMEM62 pAb (ATL-HPA062359) Datasheet (External Link)
Vendor Page Anti TMEM62 pAb (ATL-HPA062359) at Atlas Antibodies

Documents & Links for Anti TMEM62 pAb (ATL-HPA062359)
Datasheet Anti TMEM62 pAb (ATL-HPA062359) Datasheet (External Link)
Vendor Page Anti TMEM62 pAb (ATL-HPA062359)