Anti TMEM59L pAb (ATL-HPA070701)

Atlas Antibodies

SKU:
ATL-HPA070701-25
  • Immunofluorescent staining of human cell line U-2 OS shows localization to actin filaments.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: transmembrane protein 59-like
Gene Name: TMEM59L
Alternative Gene Name: BSMAP, C19orf4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035964: 66%, ENSRNOG00000022432: 66%
Entrez Gene ID: 25789
Uniprot ID: Q9UK28
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SARDPFAPQLGDTQNCQLRCRDRDLGPQPSQAGLEGASESPYDRAVLISACER
Gene Sequence SARDPFAPQLGDTQNCQLRCRDRDLGPQPSQAGLEGASESPYDRAVLISACER
Gene ID - Mouse ENSMUSG00000035964
Gene ID - Rat ENSRNOG00000022432
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti TMEM59L pAb (ATL-HPA070701)
Datasheet Anti TMEM59L pAb (ATL-HPA070701) Datasheet (External Link)
Vendor Page Anti TMEM59L pAb (ATL-HPA070701) at Atlas Antibodies

Documents & Links for Anti TMEM59L pAb (ATL-HPA070701)
Datasheet Anti TMEM59L pAb (ATL-HPA070701) Datasheet (External Link)
Vendor Page Anti TMEM59L pAb (ATL-HPA070701)