Anti TMEM55B pAb (ATL-HPA048528)

Atlas Antibodies

Catalog No.:
ATL-HPA048528-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: transmembrane protein 55B
Gene Name: TMEM55B
Alternative Gene Name: C14orf9, MGC26684
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035953: 100%, ENSRNOG00000009948: 100%
Entrez Gene ID: 90809
Uniprot ID: Q86T03
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GHPAVLPGEDPPPYSPLTSPDSGSAPMITCRVCQS
Gene Sequence GHPAVLPGEDPPPYSPLTSPDSGSAPMITCRVCQS
Gene ID - Mouse ENSMUSG00000035953
Gene ID - Rat ENSRNOG00000009948
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TMEM55B pAb (ATL-HPA048528)
Datasheet Anti TMEM55B pAb (ATL-HPA048528) Datasheet (External Link)
Vendor Page Anti TMEM55B pAb (ATL-HPA048528) at Atlas Antibodies

Documents & Links for Anti TMEM55B pAb (ATL-HPA048528)
Datasheet Anti TMEM55B pAb (ATL-HPA048528) Datasheet (External Link)
Vendor Page Anti TMEM55B pAb (ATL-HPA048528)