Anti TMEM55B pAb (ATL-HPA048528)
Atlas Antibodies
- Catalog No.:
- ATL-HPA048528-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: TMEM55B
Alternative Gene Name: C14orf9, MGC26684
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035953: 100%, ENSRNOG00000009948: 100%
Entrez Gene ID: 90809
Uniprot ID: Q86T03
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GHPAVLPGEDPPPYSPLTSPDSGSAPMITCRVCQS |
| Gene Sequence | GHPAVLPGEDPPPYSPLTSPDSGSAPMITCRVCQS |
| Gene ID - Mouse | ENSMUSG00000035953 |
| Gene ID - Rat | ENSRNOG00000009948 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TMEM55B pAb (ATL-HPA048528) | |
| Datasheet | Anti TMEM55B pAb (ATL-HPA048528) Datasheet (External Link) |
| Vendor Page | Anti TMEM55B pAb (ATL-HPA048528) at Atlas Antibodies |
| Documents & Links for Anti TMEM55B pAb (ATL-HPA048528) | |
| Datasheet | Anti TMEM55B pAb (ATL-HPA048528) Datasheet (External Link) |
| Vendor Page | Anti TMEM55B pAb (ATL-HPA048528) |