Anti TMEM54 pAb (ATL-HPA061992)
Atlas Antibodies
- Catalog No.:
- ATL-HPA061992-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: TMEM54
Alternative Gene Name: CAC-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028786: 76%, ENSRNOG00000024259: 73%
Entrez Gene ID: 113452
Uniprot ID: Q969K7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | IAMTFATQGKALLAACTFGSSELLALAPDCPFD |
| Gene Sequence | IAMTFATQGKALLAACTFGSSELLALAPDCPFD |
| Gene ID - Mouse | ENSMUSG00000028786 |
| Gene ID - Rat | ENSRNOG00000024259 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TMEM54 pAb (ATL-HPA061992) | |
| Datasheet | Anti TMEM54 pAb (ATL-HPA061992) Datasheet (External Link) |
| Vendor Page | Anti TMEM54 pAb (ATL-HPA061992) at Atlas Antibodies |
| Documents & Links for Anti TMEM54 pAb (ATL-HPA061992) | |
| Datasheet | Anti TMEM54 pAb (ATL-HPA061992) Datasheet (External Link) |
| Vendor Page | Anti TMEM54 pAb (ATL-HPA061992) |