Anti TMEM42 pAb (ATL-HPA052569)
Atlas Antibodies
- Catalog No.:
- ATL-HPA052569-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: TMEM42
Alternative Gene Name: MGC29956
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000066233: 64%, ENSRNOG00000032027: 67%
Entrez Gene ID: 131616
Uniprot ID: Q69YG0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MAERPGPPGGAVSATAYPDTPAEFPPHLQAGAMRRR |
Gene Sequence | MAERPGPPGGAVSATAYPDTPAEFPPHLQAGAMRRR |
Gene ID - Mouse | ENSMUSG00000066233 |
Gene ID - Rat | ENSRNOG00000032027 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti TMEM42 pAb (ATL-HPA052569) | |
Datasheet | Anti TMEM42 pAb (ATL-HPA052569) Datasheet (External Link) |
Vendor Page | Anti TMEM42 pAb (ATL-HPA052569) at Atlas Antibodies |
Documents & Links for Anti TMEM42 pAb (ATL-HPA052569) | |
Datasheet | Anti TMEM42 pAb (ATL-HPA052569) Datasheet (External Link) |
Vendor Page | Anti TMEM42 pAb (ATL-HPA052569) |