Anti TMEM41B pAb (ATL-HPA014946)

Atlas Antibodies

Catalog No.: ATL-HPA014946-25

Protein Description: transmembrane protein 41B
Gene Name: TMEM41B
Alternative Gene Name: KIAA0033
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047554: 61%, ENSRNOG00000010752: 69%
Entrez Gene ID: 440026
Uniprot ID: Q5BJD5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MAKGRVAERSQLGAHHTTPVGDGAAGTRGLAAPGSRDHQKEKSWVEAGS
• Gene Sequence: MAKGRVAERSQLGAHHTTPVGDGAAGTRGLAAPGSRDHQKEKSWVEAGS
• Gene ID - Mouse: ENSMUSG00000047554
• Gene ID - Rat: ENSRNOG00000010752
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TMEM41B pAb (ATL-HPA014946) – 3 Found

Morita, Keigo; Hama, Yutaro; Izume, Tamaki; Tamura, Norito; Ueno, Toshihide; Yamashita, Yoshihiro; Sakamaki, Yuriko; Mimura, Kaito; Morishita, Hideaki; Shihoya, Wataru; Nureki, Osamu; Mano, Hiroyuki; Mizushima, Noboru. Genome-wide CRISPR screen identifies TMEM41B as a gene required for autophagosome formation. The Journal Of Cell Biology. 2018;217(11):3817-3828. 

Moretti, Francesca; Bergman, Phil; Dodgson, Stacie; Marcellin, David; Claerr, Isabelle; Goodwin, Jonathan M; DeJesus, Rowena; Kang, Zhao; Antczak, Christophe; Begue, Damien; Bonenfant, Debora; Graff, Alexandra; Genoud, Christel; Reece-Hoyes, John S; Russ, Carsten; Yang, Zinger; Hoffman, Gregory R; Mueller, Matthias; Murphy, Leon O; Xavier, Ramnik J; Nyfeler, Beat. TMEM41B is a novel regulator of autophagy and lipid mobilization. Embo Reports. 2018;19(9) 

van de Weijer, Michael L; Krshnan, Logesvaran; Liberatori, Sabrina; Guerrero, Elena Navarro; Robson-Tull, Jacob; Hahn, Lilli; Lebbink, Robert Jan; Wiertz, Emmanuel J H J; Fischer, Roman; Ebner, Daniel; Carvalho, Pedro. Quality Control of ER Membrane Proteins by the RNF185/Membralin Ubiquitin Ligase Complex. Molecular Cell. 2020;79(5):768-781.e7.