Anti TMEM38B pAb (ATL-HPA018465 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA018465-100

Protein Description: transmembrane protein 38B
Gene Name: TMEM38B
Alternative Gene Name: bA219P18.1, C9orf87, D4Ertd89e, FLJ10493, TRIC-B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028420: 53%, ENSRNOG00000028063: 52%
Entrez Gene ID: 55151
Uniprot ID: Q9NVV0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FEDTLSWMLFGWQQPFSSCEKKSEAKSPSNGVGSLASKPVDVASDNV
• Gene Sequence: FEDTLSWMLFGWQQPFSSCEKKSEAKSPSNGVGSLASKPVDVASDNV
• Gene ID - Mouse: ENSMUSG00000028420
• Gene ID - Rat: ENSRNOG00000028063
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.