Anti TMEM38A pAb (ATL-HPA050463 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA050463-100
- Shipping:
- Calculated at Checkout
$596.00
Gene Name: TMEM38A
Alternative Gene Name: MGC3169, TRIC-A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031791: 78%, ENSRNOG00000011912: 78%
Entrez Gene ID: 79041
Uniprot ID: Q9H6F2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | THSHSSPFDALEGYICPVLFGSACGGDHHHDNHGGSHSGGGPGAQHSAMPAKSKEELSEGSRKK |
Gene Sequence | THSHSSPFDALEGYICPVLFGSACGGDHHHDNHGGSHSGGGPGAQHSAMPAKSKEELSEGSRKK |
Gene ID - Mouse | ENSMUSG00000031791 |
Gene ID - Rat | ENSRNOG00000011912 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti TMEM38A pAb (ATL-HPA050463 w/enhanced validation) | |
Datasheet | Anti TMEM38A pAb (ATL-HPA050463 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti TMEM38A pAb (ATL-HPA050463 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti TMEM38A pAb (ATL-HPA050463 w/enhanced validation) | |
Datasheet | Anti TMEM38A pAb (ATL-HPA050463 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti TMEM38A pAb (ATL-HPA050463 w/enhanced validation) |