Anti TMEM33 pAb (ATL-HPA075863)
Atlas Antibodies
- Catalog No.:
- ATL-HPA075863-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: TMEM33
Alternative Gene Name: FLJ10525
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037720: 91%, ENSRNOG00000002254: 94%
Entrez Gene ID: 55161
Uniprot ID: P57088
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LHAATYTKKVLDARGSNSLPLLRSVLDKLSANQQ |
Gene Sequence | LHAATYTKKVLDARGSNSLPLLRSVLDKLSANQQ |
Gene ID - Mouse | ENSMUSG00000037720 |
Gene ID - Rat | ENSRNOG00000002254 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti TMEM33 pAb (ATL-HPA075863) | |
Datasheet | Anti TMEM33 pAb (ATL-HPA075863) Datasheet (External Link) |
Vendor Page | Anti TMEM33 pAb (ATL-HPA075863) at Atlas Antibodies |
Documents & Links for Anti TMEM33 pAb (ATL-HPA075863) | |
Datasheet | Anti TMEM33 pAb (ATL-HPA075863) Datasheet (External Link) |
Vendor Page | Anti TMEM33 pAb (ATL-HPA075863) |