Anti TMEM33 pAb (ATL-HPA075863)

Atlas Antibodies

Catalog No.:
ATL-HPA075863-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: transmembrane protein 33
Gene Name: TMEM33
Alternative Gene Name: FLJ10525
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037720: 91%, ENSRNOG00000002254: 94%
Entrez Gene ID: 55161
Uniprot ID: P57088
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LHAATYTKKVLDARGSNSLPLLRSVLDKLSANQQ
Gene Sequence LHAATYTKKVLDARGSNSLPLLRSVLDKLSANQQ
Gene ID - Mouse ENSMUSG00000037720
Gene ID - Rat ENSRNOG00000002254
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TMEM33 pAb (ATL-HPA075863)
Datasheet Anti TMEM33 pAb (ATL-HPA075863) Datasheet (External Link)
Vendor Page Anti TMEM33 pAb (ATL-HPA075863) at Atlas Antibodies

Documents & Links for Anti TMEM33 pAb (ATL-HPA075863)
Datasheet Anti TMEM33 pAb (ATL-HPA075863) Datasheet (External Link)
Vendor Page Anti TMEM33 pAb (ATL-HPA075863)