Anti TMEM268 pAb (ATL-HPA017199)

Atlas Antibodies

Catalog No.: ATL-HPA017199-25

Protein Description: transmembrane protein 268
Gene Name: TMEM268
Alternative Gene Name: C9orf91, DKFZp547P234, FLJ38045
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045917: 88%, ENSRNOG00000008712: 87%
Entrez Gene ID: 203197
Uniprot ID: Q5VZI3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SVIQLWFVYFDLENCVQFLSDHVQEMKTSQESLLRSRLSQLCVVMETGVSPATAEGPENLEDAPLLPGNSCPNERPLMQTELHQLVPEAEPEEMARQLLAVFGGYYIRLLVTSQ
• Gene Sequence: SVIQLWFVYFDLENCVQFLSDHVQEMKTSQESLLRSRLSQLCVVMETGVSPATAEGPENLEDAPLLPGNSCPNERPLMQTELHQLVPEAEPEEMARQLLAVFGGYYIRLLVTSQ
• Gene ID - Mouse: ENSMUSG00000045917
• Gene ID - Rat: ENSRNOG00000008712
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TMEM268 pAb (ATL-HPA017199) – 1 Found

Hong, Dubeiqi; Zhang, Xuan; Li, Riyong; Yu, Jiahong; Lou, Yaxin; He, Qihua; Li, Xuanze; Xu, Dong; Lv, Ping; Lin, Jian; Chen, Yingyu. Deletion of TMEM268 inhibits growth of gastric cancer cells by downregulating the ITGB4 signaling pathway. Cell Death And Differentiation. 2019;26(8):1453-1466.