Anti TMEM266 pAb (ATL-HPA049425)

Atlas Antibodies

Catalog No.:
ATL-HPA049425-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: transmembrane protein 266
Gene Name: TMEM266
Alternative Gene Name: C15orf27, FLJ38190
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032313: 95%, ENSRNOG00000015201: 94%
Entrez Gene ID: 123591
Uniprot ID: Q2M3C6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YVLPVKLEMEMVIQQYEKAKVIQDEQLERLTQICQEQGFEIRQLRAHLAQQDLDLAAEREAALQAPHVLSQPRSRFKVLE
Gene Sequence YVLPVKLEMEMVIQQYEKAKVIQDEQLERLTQICQEQGFEIRQLRAHLAQQDLDLAAEREAALQAPHVLSQPRSRFKVLE
Gene ID - Mouse ENSMUSG00000032313
Gene ID - Rat ENSRNOG00000015201
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TMEM266 pAb (ATL-HPA049425)
Datasheet Anti TMEM266 pAb (ATL-HPA049425) Datasheet (External Link)
Vendor Page Anti TMEM266 pAb (ATL-HPA049425) at Atlas Antibodies

Documents & Links for Anti TMEM266 pAb (ATL-HPA049425)
Datasheet Anti TMEM266 pAb (ATL-HPA049425) Datasheet (External Link)
Vendor Page Anti TMEM266 pAb (ATL-HPA049425)