Anti TMEM261 pAb (ATL-HPA014585)

Atlas Antibodies

Catalog No.:
ATL-HPA014585-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: transmembrane protein 261
Gene Name: TMEM261
Alternative Gene Name: C9orf123, MGC4730
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028398: 49%, ENSRNOG00000023946: 41%
Entrez Gene ID: 90871
Uniprot ID: Q96GE9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MGSRLSQPFESYITAPPGTAAAPAKPAPPATPGAPTSPAEHRLLKTCWSC
Gene Sequence MGSRLSQPFESYITAPPGTAAAPAKPAPPATPGAPTSPAEHRLLKTCWSC
Gene ID - Mouse ENSMUSG00000028398
Gene ID - Rat ENSRNOG00000023946
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TMEM261 pAb (ATL-HPA014585)
Datasheet Anti TMEM261 pAb (ATL-HPA014585) Datasheet (External Link)
Vendor Page Anti TMEM261 pAb (ATL-HPA014585) at Atlas Antibodies

Documents & Links for Anti TMEM261 pAb (ATL-HPA014585)
Datasheet Anti TMEM261 pAb (ATL-HPA014585) Datasheet (External Link)
Vendor Page Anti TMEM261 pAb (ATL-HPA014585)