Anti TMEM259 pAb (ATL-HPA054801)

Atlas Antibodies

Catalog No.:
ATL-HPA054801-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: transmembrane protein 259
Gene Name: TMEM259
Alternative Gene Name: ASBABP1, C19orf6, MBRL, MGC4022
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000013858: 47%, ENSRNOG00000012808: 49%
Entrez Gene ID: 91304
Uniprot ID: Q4ZIN3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AAGGDLGWMAETAAIITDASFLSGLSASLLERRPASPLGPAGGLPHAPQDSVPPSDSAASDTTPLGAAVGGPSPASM
Gene Sequence AAGGDLGWMAETAAIITDASFLSGLSASLLERRPASPLGPAGGLPHAPQDSVPPSDSAASDTTPLGAAVGGPSPASM
Gene ID - Mouse ENSMUSG00000013858
Gene ID - Rat ENSRNOG00000012808
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TMEM259 pAb (ATL-HPA054801)
Datasheet Anti TMEM259 pAb (ATL-HPA054801) Datasheet (External Link)
Vendor Page Anti TMEM259 pAb (ATL-HPA054801) at Atlas Antibodies

Documents & Links for Anti TMEM259 pAb (ATL-HPA054801)
Datasheet Anti TMEM259 pAb (ATL-HPA054801) Datasheet (External Link)
Vendor Page Anti TMEM259 pAb (ATL-HPA054801)