Anti TMEM259 pAb (ATL-HPA054801)
Atlas Antibodies
- Catalog No.:
- ATL-HPA054801-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: TMEM259
Alternative Gene Name: ASBABP1, C19orf6, MBRL, MGC4022
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000013858: 47%, ENSRNOG00000012808: 49%
Entrez Gene ID: 91304
Uniprot ID: Q4ZIN3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | AAGGDLGWMAETAAIITDASFLSGLSASLLERRPASPLGPAGGLPHAPQDSVPPSDSAASDTTPLGAAVGGPSPASM |
| Gene Sequence | AAGGDLGWMAETAAIITDASFLSGLSASLLERRPASPLGPAGGLPHAPQDSVPPSDSAASDTTPLGAAVGGPSPASM |
| Gene ID - Mouse | ENSMUSG00000013858 |
| Gene ID - Rat | ENSRNOG00000012808 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TMEM259 pAb (ATL-HPA054801) | |
| Datasheet | Anti TMEM259 pAb (ATL-HPA054801) Datasheet (External Link) |
| Vendor Page | Anti TMEM259 pAb (ATL-HPA054801) at Atlas Antibodies |
| Documents & Links for Anti TMEM259 pAb (ATL-HPA054801) | |
| Datasheet | Anti TMEM259 pAb (ATL-HPA054801) Datasheet (External Link) |
| Vendor Page | Anti TMEM259 pAb (ATL-HPA054801) |